TNNI3 anticorps

N° du produit ABIN633170

L’anticorps Lapin Polyclonal anti-TNNI3 a été validé pour WB. Il convient pour détecter TNNI3 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour TNNI3 anticorps (ABIN633170)

Antigène: TNNI3 (Cardiac Troponin I (TNNI3))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNNI3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TNNI3 anticorps

Purification: Affinity purified

Immunogène: Troponin I Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Troponin I Type 3 Blocking Peptide, (ABIN5616804), is also available for use as a blocking control in assays to test for specificity of this Troponin I Type 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNI3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TNNI3

Antigène: TNNI3 (Cardiac Troponin I (TNNI3))

Sujet: Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit, blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. TNNI3 is the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues.

Poids moléculaire: 23 kDa (MW of target protein)